Recombinant Aspergillus oryzae Protein get1 (get1)
This Recombinant Aspergillus oryzae Protein get1 (get1) spans the amino acid sequence from region 1-196.
Product Specifications
Product Name Alternative
Protein get1, Guided entry of tail-anchored proteins 1
UniProt
Q2UG70
Expression Region
1-196
Origin
Aspergillus oryzae (strain ATCC 42149 / RIB 40) (Yellow koji mold)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLSLIWTIFFLHVAIYVVNTAGASTIDSLLWLLYLKLPTSTSKNAREQSRLKREALELKR DMNNTSSQDEFAKWAKLRRRHDKTMDEYEQLNKTLTAQKSSFDWSVKIARWLSTNGLKIF LQFWYSKTPVFALPEAWIPYYVQWILSFPRAPMGSVSVHVWNSVCATAVSVTAEMVTSMF LQTARPTPVATAQKTQ
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6008740-01 0.2 mL
LGR5, ID (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38)
Sign In for Pricing
View Details MBS6008740-02 5x 0.2 mL
LGR5, ID (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38)
Sign In for Pricing
View Details 
MBS7099257 Inquire
Recombinant Vibrio cholerae serotype O1 Putative zinc metalloprotease VC_2253 (VC_2253), partial
Sign In for Pricing
View Details