Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Protein RER1 (Rer1)

This Recombinant Rat Protein RER1 (Rer1) spans the amino acid sequence from region 1-196.

Product Specifications

Product Name Alternative

Protein RER1

UniProt

Q498C8

Expression Region

1-196

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSEGDSVGDSVHGKPSVVYRFFSRLGQIYQSWLDKSTPYTAVRWVVTLGLSFVYMIRVYL LQGWYIVTYALGIYHLNLFIAFLSPKVDPSLMEDSDDGPSLPTKQNEEFRPFIRRLPEFK FWHAATKGILVAMICTFFEAFNVPVFWPILVMYFIMLFCITMKRQIKHMIKYRYIPFTHG KRRYKGKEDVGKTFAS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

GNB5 Rabbit Polyclonal Antibody (HRP)
orb2082767 100 µL

GNB5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Human Monoclonal IL12B Antibody (ebdarokimab) [Janelia Fluor 635]
NBP3-28551JF635 0.1 mL

Human Monoclonal IL12B Antibody (ebdarokimab) [Janelia Fluor 635]

Sign In for Pricing
View Details
Mouse Ifi47 (NM_008330) AAV Particle
MR206684A1V 250 µL

Mouse Ifi47 (NM_008330) AAV Particle

Sign In for Pricing
View Details
Streptavidin antibody (HRP)
MBS536037 Inquire

Streptavidin antibody (HRP)

Sign In for Pricing
View Details
PIRC43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV740587 1.0 µg DNA

PIRC43 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1) Mouse ELISA Kit
E6382 96 Tests

Leucine-rich repeat and coiled-coil domain-containing protein 1 (LRRCC1) Mouse ELISA Kit

Sign In for Pricing
View Details