Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GNB5 Rabbit Polyclonal Antibody (HRP)

GNB5 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GB5, IDDCA, LADCI, gbeta5

UniProt

O14775

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human GBB5

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MRSGQCVQAFETHESDINSVRYYPSGDAFASGSDDATCRLYDLRADREVA

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_057278

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal C12orf4 Antibody [Alexa Fluor 647]
NBP3-21423AF647 0.1 mL

Rabbit Polyclonal C12orf4 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Mouse Neutrophil Elastase ELISA Kit
SEKM-0237-01 48 Tests

Mouse Neutrophil Elastase ELISA Kit

Sign In for Pricing
View Details
Mouse Neutrophil Elastase ELISA Kit
SEKM-0237-02 96 Tests

Mouse Neutrophil Elastase ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti Rat MT1 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)
IRBARTMT1AP028200UL 1 Each

Rabbit Anti Rat MT1 Polyclonal Affinity Purified (PBS with 0.05% Proclin300 and 50% glycerol, pH7.4.) (IHC)

Sign In for Pricing
View Details
Rabbit Polyclonal Chymotrypsin-like protease Antibody
NBP1-87520 0.1 mL

Rabbit Polyclonal Chymotrypsin-like protease Antibody

Sign In for Pricing
View Details
Lentiviral mouse Fbxo32 shRNA (UAS) - Lentiviral mouse Fbxo32 shRNA (UAS) (25)
GTR15252041 1 Vial

Lentiviral mouse Fbxo32 shRNA (UAS) - Lentiviral mouse Fbxo32 shRNA (UAS) (25)

Sign In for Pricing
View Details