Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0945 (MJ0945)
This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0945 (MJ0945) spans the amino acid sequence from region 1-224.
Product Specifications
Product Name Alternative
Uncharacterized protein MJ0945
UniProt
Q58355
Expression Region
1-224
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLLRQYINVPRLGEIMNLKELTVILIIPIVYLGVCGCFEIVPKSFYDNFSSYNVGDKAPF GEWKVKEGGFKIEAILSEDKKTLNKVAVPINNGIIYIDKNYTDFKFIVDIKRLEESDSPK IYFRLINNANAGYYIDIEGFDRGYVLYKFNGTKVEKLAESYDAAPAGTDFYRYEVVAKDN KIIFLAGGQKYIEYTDNNTPILKGGIGIGGGRAYYDNVRVEPIE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6475646-01 0.2 mL
FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (Azide free) (HRP)
Sign In for Pricing
View Details MBS6475646-02 5x 0.2 mL
FABP4, Phosphorylated (Tyr20) (Fatty Acid-binding Protein, Adipocyte, Adipocyte-type Fatty Acid-binding Protein, A-FABP, AFABP, Fatty Acid-binding Protein 4, Adipocyte Lipid-binding Protein, ALBP) (Azide free) (HRP)
Sign In for Pricing
View Details