Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Debaryomyces hansenii Mitochondrial intermembrane space import and assembly protein 40 (MIA40)

This Recombinant Debaryomyces hansenii Mitochondrial intermembrane space import and assembly protein 40 (MIA40) spans the amino acid sequence from region 23-249.

Product Specifications

Product Name Alternative

Mitochondrial intermembrane space import and assembly protein 40, Mitochondrial import inner membrane translocase TIM40

UniProt

Q6BSK8

Expression Region

23-249

Origin

Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) (Yeast) (Torulaspora hansenii)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

SNQGFRAAKASKTNMYLGAGIALIPVIMSINYLNGNHIANEVDENKVEEGKKKAESTGKK EFVEKAEKEAIGKADVKTKVPAEEANPETRTETDKPSEESQKDEENSYEGAAYNPETGEI NWDCPCLGGMAHGPCGEEFKEAFACFIYSESEPKGIECIKKFESMRNCFREHPEHYKEEL YDDEEQEPLVDVNEKKGDASEQSAETIADDATKVVKEKAKAEDSNTK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal HDAC7 Antibody
NB100-61587 100 µL

Rabbit Polyclonal HDAC7 Antibody

Sign In for Pricing
View Details
OLFM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
32494111 3x 1.0 µg

OLFM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Na+/K+-ATPase alpha2 discontinued
539411-01 30ul

Na+/K+-ATPase alpha2 discontinued

Sign In for Pricing
View Details
Na+/K+-ATPase alpha2 discontinued
539411-02 100 µL

Na+/K+-ATPase alpha2 discontinued

Sign In for Pricing
View Details
CLNK Peptide - C-terminal region
orb2007018 100 µg

CLNK Peptide - C-terminal region

Sign In for Pricing
View Details
ING4 ORF Vector (Human) (pORF)
ORF005385 1.0 µg DNA

ING4 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details