Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLNK Peptide - C-terminal region

CLNK Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC35197, MIST

UniProt

Q7Z7G1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLNK Rabbit Polyclonal Antibody (orb326530) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443196

Preservative

Lyophilized powder

AA Sequence

SRQAVEEAFMKENKDGSFLVRDCSTKSKEEPYVLAVFYENKVYNVKIRFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

rac-Ruxolitinib
TRC-R701995-5MG 5 mg

rac-Ruxolitinib

Sign In for Pricing
View Details
TFF1 Recombinant Protein
32-1756-20 20 µg

TFF1 Recombinant Protein

Sign In for Pricing
View Details
Anti-MAF antibody
PAab04929 100 µg

Anti-MAF antibody

Sign In for Pricing
View Details
LRP2BP antibody
70R-3858 50 ug

LRP2BP antibody

Sign In for Pricing
View Details
IRAK4 Polyclonal Antibody, PE Conjugated
bs-2440R-PE-01 20 µL

IRAK4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details
IRAK4 Polyclonal Antibody, PE Conjugated
bs-2440R-PE-02 100 µL

IRAK4 Polyclonal Antibody, PE Conjugated

Sign In for Pricing
View Details