Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFF1 Recombinant Protein

Source : Escherichia Coli. TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved interamolecular disulfide bonds and having a total molecular mass of 13.2 kDa. TFF-1 Human Recombinant is purified by proprietary chromatographic techniques. The Trefoil Factor peptides (TFF1, TFF2 and TFF3) are stable secretory proteins expressed in the gastrointestinal tract (gastric mucosa), and are involved in intestinal mucosal defense and repair. TFF1 is an essential protein for normal differentiation of the antral and pyloric gastric mucosa and functions as a gastric-specific tumor suppressor gene. TFF1 is a stabilizer of the mucous gel overlying the gastrointestinal mucosa that provides a physical barrier against various noxious agents. TFF1 protects the mucosa from isults, stabilizes the mucus layer, & affects healing of the epithelium. TFF1 is commonly expressed in tumors. TFF1 is related with the cell membrane of MCF-7 cells. High levels of TFF1 and TFF2 are found in serum from inflammatory bowel disease.

Product Specifications

Product Name Alternative

TFF-1||TFF1||pS2||BCEI||HPS||HP1.A||pNR-2||D21S21||pS2 protein||Trefoil factor 1||Breast cancer estrogen-inducible protein.

Purification

Greater than 97.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.

Components

The protein was lyophilized after dialysis against 1xPBS pH-7.4.

Storage Conditions

Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA) .Please prevent freeze-thaw cycles.

Applications Notes

It is recommended to reconstitute the lyophilized TFF1 in sterile 18MΩ-cm H2O not less than 100μg/ml, which can then be further diluted to other aqueous solutions. The ED50 as determined by a chemotaxis bioassay using human MCF-7 cells is less than 10μg/ml, corresponding to a specific activity of >100 IU/mg.

Amino Acids

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF.

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Thyrotropin-Releasing Hormone, Prepro- (83-106)
T9014-05N 1 mg

Thyrotropin-Releasing Hormone, Prepro- (83-106)

Ask
View Details
Rabbit anti-Escherichia coli ROP Polyclonal Antibody
MBS7161904 Inquire

Rabbit anti-Escherichia coli ROP Polyclonal Antibody

Ask
View Details
mmu-miR-6962-5p miRNA Mimic
MBS8302025-01 5 nmol

mmu-miR-6962-5p miRNA Mimic

Ask
View Details
mmu-miR-6962-5p miRNA Mimic
MBS8302025-02 10 nmol

mmu-miR-6962-5p miRNA Mimic

Ask
View Details
mmu-miR-6962-5p miRNA Mimic
MBS8302025-03 5x 10 nmol

mmu-miR-6962-5p miRNA Mimic

Ask
View Details
Human POLR3D Pre-designed siRNA Set A
SI012538A 1 Each

Human POLR3D Pre-designed siRNA Set A

Ask
View Details