Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 174 (Tmem174)

This Recombinant Rat Transmembrane protein 174 (Tmem174) spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Transmembrane protein 174

UniProt

Q68FU0

Expression Region

1-243

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEQSSNRPEDFPLNVFSVTPYTPSTADIQVSDDDKAGATLLFSGIFLGLVGITFTVMGWI KYQGVSHFEWTQLLGPILLSVGVTFILISVCKFKMLSCQLCTDNEERVLDSDQTSGGQSF VFTGINQPITFHGATVVQYIPPPYGSQEPLGMNTTYLQPMMNPCGLVPSSGAVAATPSPP QYYTIYPQDNAAFVESEGFSPFVGAGHDRPSSDADQLEGTQMGEEERVCFSPPPYEEIYA LPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NSUN2 Human Gene Knockout Kit (CRISPR)
KN214459BN 1 Kit

NSUN2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human MMP-3 Recombinant Rabbit Monoclonal Antibody [PSH07-62] - BSA and Azide free (Detector)
HA722878 100 µL

Human MMP-3 Recombinant Rabbit Monoclonal Antibody [PSH07-62] - BSA and Azide free (Detector)

Sign In for Pricing
View Details
Tissue Total RNA, Colon: sigmoid
CR559084 5 µg

Tissue Total RNA, Colon: sigmoid

Sign In for Pricing
View Details
Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF640R conjugate, 0.1mg/mL
BNC401058-100 1x 100 µL

Human Papillomavirus 16 (HPV-16) (HPV16/1058), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucosyl-C18-sphingosine
TRC-G596840-2.5MG 2.5 mg

Glucosyl-C18-sphingosine

Sign In for Pricing
View Details
GDF-8 Polyclonal Antibody
D-AB-10385L-01 25 µL

GDF-8 Polyclonal Antibody

Sign In for Pricing
View Details