Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cytochrome c oxidase subunit 2

This Recombinant Cytochrome c oxidase subunit 2 spans the amino acid sequence from region 1-243.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

P29163

Expression Region

1-243

Origin

Pneumocystis carinii

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNNIIHNDAPTPWGIYFQDGASPVYDGIVELHDQVLFYLLIVLVGVSWILFSTILRFRGS GIVHKYHNHSTTIEFVWTVSPALLLIAIAFPSFKLLYLMDEVIDPSITIKAIGHQWYWSY EYSDYTDKEGQSIEFDSYMLPTEDLEEGQLRQLEVDNRVLVPVNTPLRFIITATDVLHDF AVPSLGIKVDASPGRLNQVSTYVQREGVYYGQCSELCGVLHSSMPIVIEAVSLEKFLSWL DNQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-PDE3B Antibody, Affinity Purified
A302-742A 100 µg

Rabbit anti-PDE3B Antibody, Affinity Purified

Sign In for Pricing
View Details
WM-600-624-PK Adhesive-backed Marker Combination Packs
112252 625 Pack (25 Label (s) x 25 Card)

WM-600-624-PK Adhesive-backed Marker Combination Packs

Sign In for Pricing
View Details
PRMT1 (PRMT1-171) : m-IgG1 BP-HRP Bundle
sc-541285 1 Kit

PRMT1 (PRMT1-171) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 490)
MBS6455882-01 0.1 mL

Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 490)

Sign In for Pricing
View Details
Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 490)
MBS6455882-02 5x 0.1 mL

Eras (GTPase ERas, E-Ras, Embryonic Stem Cell-Expressed Ras, Eras) (MaxLight 490)

Sign In for Pricing
View Details
Dual specificity protein phosphatase 10 Antibody / DUSP10
F54969-0.4ML 0.4 mL

Dual specificity protein phosphatase 10 Antibody / DUSP10

Sign In for Pricing
View Details