Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Abhydrolase domain-containing protein 14A (Abhd14a)

This Recombinant Mouse Abhydrolase domain-containing protein 14A (Abhd14a) spans the amino acid sequence from region 1-247.

Product Specifications

Product Name Alternative

Abhydrolase domain-containing protein 14A, EC= 3.-.-.-, Down-regulated in Zic-1-mutant protein

UniProt

Q922Q6

Expression Region

1-247

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVQKFMSRYQAALLGLGLLLVFLLYMGLPGPPEQTSRLWRGPNVTVLTGLTRGNSRIFYR EVLPIQQACRAEVVFLHGKAFNSHTWEQLGTLQLLSERGYRAVAIDLPGFGNSAPSEEVS TEAGRVELLERVFQDLQVQNTVLVSPSLSGSYALPFLMQNHHQLRGFVPIAPTYTRNYAQ EQFRAVKTPTLILYGELDHTLARESLQQLRHLPNHSMVKLRDAGHACYLHKPEAFHLALL AFLDHLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL
BNC403107-100 1x 100 µL

CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pus1 Mouse Gene Knockout Kit (CRISPR)
KN514259 1 Kit

Pus1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR119 (NM_178471) Human Over-expression Lysate
LC403605 20 µg

GPR119 (NM_178471) Human Over-expression Lysate

Sign In for Pricing
View Details
Fos B (FOSB) (NM_006732) Human Over-expression Lysate
LY402011 100 µg

Fos B (FOSB) (NM_006732) Human Over-expression Lysate

Sign In for Pricing
View Details
EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]
HA722206 100 µL

EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]

Sign In for Pricing
View Details
Tissue FFPE Sections, Gallbladder
CS800670 5x 5 µm

Tissue FFPE Sections, Gallbladder

Sign In for Pricing
View Details