Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Apocytochrome f (petA)

This Recombinant Prochlorococcus marinus Apocytochrome f (petA) spans the amino acid sequence from region 35-317.

Product Specifications

Product Name Alternative

Apocytochrome f

UniProt

Q31C73

Expression Region

35-317

Origin

Prochlorococcus marinus (strain MIT 9312)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YPFWAQQNYESPREATGKIVCANCHLAQMPTIAEVPQSVGADSVFKAVVKIPYKNDLKEI GADGSEVPLQVGAVVMLPDGFKLAPQERWTEEIKEETEGVYFTNYSEEKDNIIIVGPLPG DTNKEIVFPVLSPDPSTNKEYHYGKYSLHIGGNRGRGQVYPTGDKSNNVVFTSSTSGTIN SIDTIEDGSYKVNIENENGEITTEAVPVGPQLIVKAQDKINAGDPLTNDPNVGGFGQLDA EVVLQSPYRVIGLIAFFIGVGLTQILLVLKKKQVEKVQAAEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N,N′-Disuccinimidyl Carbonate
TRC-D493540-1G 1 g

N,N′-Disuccinimidyl Carbonate

Sign In for Pricing
View Details
SAP30L (NM_001131063) Human Over-expression Lysate
LY427373 100 µg

SAP30L (NM_001131063) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708571 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Thyroglobulin (2H11), 0.2mg/mL
BNUB0023-100 1x 100 µL

Thyroglobulin (2H11), 0.2mg/mL

Sign In for Pricing
View Details
ExoBriteTM 650/665 Annexin EV Staining Kit, 100 labelings
#30122-T 1 Kit

ExoBriteTM 650/665 Annexin EV Staining Kit, 100 labelings

Sign In for Pricing
View Details
Grp75 Recombinant Mouse Monoclonal Antibody [6-A9-R]
HA601253 100 µL

Grp75 Recombinant Mouse Monoclonal Antibody [6-A9-R]

Sign In for Pricing
View Details