Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3)

This Recombinant Cryptococcus gattii serotype B Probable endonuclease LCL3 (LCL3) spans the amino acid sequence from region 1-286.

Product Specifications

Product Name Alternative

Probable endonuclease LCL3, EC= 3.1.-.-

UniProt

E6R427

Expression Region

1-286

Origin

Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) (Filobasidiella gattii) (Cryptococcus bacillisporus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGSYSPQKDPQHPTQHQQFPPTPPYPSSSVWSGNLGENPVFIGIGSAAGASALTLLGVM GYRRYWKRIKNADYVTSELLRRRAWIKGIVTSVGDGDNLRLYHTPGPFFRYPFKIRSIPT TQKGLRNETISIRIAGVDAPENAHFGNPAQPHAKESLEWLRATILGKRMRCQLLAKDQYN RIVAVPYISRRLWWDRPLPLMMLKEGMAVVYKAGGAEYGPWGLDEMLKVEAEARDAKRGL WALRKFESPGDFKARMKLKSDVSEERPEKKSPSGWIALVKRLIRRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ipidacrine-d9 (Major)
TRC-I739332-25MG 25 mg

Ipidacrine-d9 (Major)

Sign In for Pricing
View Details
Tissue Protein Lysate, Kidney
CP565474 150 µg

Tissue Protein Lysate, Kidney

Sign In for Pricing
View Details
PTGIS (N-term) Rabbit Polyclonal Antibody
AP14903PU-N 400 µL

PTGIS (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MEOX2 Rabbit Polyclonal Antibody
HA500053 100 µL

MEOX2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mix-n-StainTM CF®488A Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling
#92585 1 Kit

Mix-n-StainTM CF®488A Nanobody Thiol Labeling Kit, 1x (5-20ug) labeling

Sign In for Pricing
View Details
EIF4B Mouse Monoclonal Antibody [Clone ID: 1F5]
AM06769PU-N 100 µg

EIF4B Mouse Monoclonal Antibody [Clone ID: 1F5]

Sign In for Pricing
View Details