Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR)

This Recombinant Vaccinia virus Plaque-size/host range protein (PS/HR) spans the amino acid sequence from region 18-317.

Product Specifications

Product Name Alternative

Plaque-size/host range protein, Protein B5

UniProt

P24084

Expression Region

18-317

Origin

Vaccinia virus (strain LC16m0) (VACV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSLDPNAVCETDKWKYENPCKKMCT VSDYVSELYDKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEH GSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLIS GSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPILPTCVRSNEKFDPVDDGPDDETDL SKLSKDVVQYEQEIESLEATYHIIIVALTIMGVIFLISVIVLVCSCDKNNDQYKFHKLLP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

15-deoxy-Δ-12,14-Prostaglandin J2
B7010-.1 100 µg

15-deoxy-Δ-12,14-Prostaglandin J2

Sign In for Pricing
View Details
Adenovirus Monoclonal Antibody
VAnt-Wyb303 Each

Adenovirus Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Mouse LOXL2/ Lysyl oxidase homolog 2 Protein, His, Yeast-1mg
QP6317-ye-1mg 1mg

Recombinant Mouse LOXL2/ Lysyl oxidase homolog 2 Protein, His, Yeast-1mg

Sign In for Pricing
View Details
ENT-GB-ETI-SKID-4A Scafftag Tagging System Kits
319411 1 Kit (1 Kit x 1 Kit)

ENT-GB-ETI-SKID-4A Scafftag Tagging System Kits

Sign In for Pricing
View Details
FLP Antibody
OADC00054-100UL 100 µL

FLP Antibody

Sign In for Pricing
View Details
Human Ephrin-B2 / EFNB2 Protein, Fc tag (MALS verified)
EPN-H5259-500ug 500 µg

Human Ephrin-B2 / EFNB2 Protein, Fc tag (MALS verified)

Sign In for Pricing
View Details