Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA)

This Recombinant p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) spans the amino acid sequence from region 1-311.

Product Specifications

Product Name Alternative

P-hydroxybenzoic acid efflux pump subunit AaeA, pHBA efflux pump protein A

UniProt

Q8ZAU9

Expression Region

1-311

Origin

Yersinia pestis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTFSLKIIRVGITVLVVVLAVIAIFNVWAFYTESPWTRDAKFTADVVAIAPDVSGLLTE VPVKDNQLVQKGQILFVIDQPRYQQALAEAEADVAYYQTLAAEKQRESSRRHRLGIQALS QEEIDQASNVLQTVQHQLAKAIAVRDLARLDLERTTVRAPAEGWVTNLNVHAGEFINRGA TAVALVKKDTFYILAYLEETKLEGVKPGYRAEITPLGSNRILHGTVDSISAGVTNSSSSA DSKGLATIDNNLEWVRLAQRVPVKIHLDSEDQQYLYPAGTTATVVITGPNDRDPHQASPM TKLMHRLREFG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant CD35 Monoclonal Antibody
AN301476L-01 50 µL

Recombinant CD35 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant CD35 Monoclonal Antibody
AN301476L-02 100 µL

Recombinant CD35 Monoclonal Antibody

Sign In for Pricing
View Details
MFAP4 (NM_001198695) Human Over-expression Lysate
LC434121 20 µg

MFAP4 (NM_001198695) Human Over-expression Lysate

Sign In for Pricing
View Details
CRHBP (NM_001882) Human Over-expression Lysate
LC419679 20 µg

CRHBP (NM_001882) Human Over-expression Lysate

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a,  30nm
GM-301-30 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a, 30nm

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF594 conjugate, 0.1mg/mL
BNC943093-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details