Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0365 protein SACOL1630 (SACOL1630)

This Recombinant Staphylococcus aureus UPF0365 protein SACOL1630 (SACOL1630) spans the amino acid sequence from region 1-329.

Product Specifications

Product Name Alternative

UPF0365 protein SACOL1630

UniProt

Q5HFI7

Expression Region

1-329

Origin

Staphylococcus aureus (strain COL)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSLSFIVIAVIIVVALLILFSFVPIGLWISALAAGVHVGIGTLVGMRLRRVSPRKVIAP LIKAHKAGLALTTNQLESHYLAGGNVDRVVDANIAAQRADIDLPFERAAAIDLAGRDVLE AVQMSVNPKVIETPFIAGVAMNGIEVKAKARITVRANIARLVGGAGEETIIARVGEGIVS TIGSSKHHTEVLENPDNISKTVLSKGLDSGTAFEILSIDIADVDISKNIGADLQTEQALA DKNIAQAKAEERRAMAVATEQEMKARVQEMHAKVVEAESEVPLAMAEALRSGNISVKDYY NLKNIEADTGMRNAINKRTDQSDDESPEH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Embigin homolog (EMB) Rabbit Polyclonal Antibody
TA375875 100 µL

Embigin homolog (EMB) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human ATXN2 protein (GST tag)
PDEH100783-01 20 µg

Recombinant Human ATXN2 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human ATXN2 protein (GST tag)
PDEH100783-02 100 µg

Recombinant Human ATXN2 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human ATXN2 protein (GST tag)
PDEH100783-03 500 µg

Recombinant Human ATXN2 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human ATXN2 protein (GST tag)
PDEH100783-04 1 mg

Recombinant Human ATXN2 protein (GST tag)

Sign In for Pricing
View Details
QuantiChrom™ β-Glucosidase Assay Kit
DBGD-100 100 Tests

QuantiChrom™ β-Glucosidase Assay Kit

Sign In for Pricing
View Details