Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis C virus Genome polyprotein

This Recombinant Hepatitis C virus Genome polyprotein spans the amino acid sequence from region 384-737.

Product Specifications

Product Name Alternative

Genome polyprotein, Cleaved into the following 4 chains:, 1. Core protein p21, Capsid protein C, p21, Core protein p19, Envelope glycoprotein E1, gp32, gp35, Envelope g

UniProt

P27960

Expression Region

384-737

Origin

Hepatitis C virus (isolate HC-J5) (HCV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

NTRTVAGSAAATTRGFTSMFSSGSKQNLQLINTNGSWHINRTALNCNDSLNTGFIASLFY VNRFNSSGCPHRLSVCRSIEAFRIGWGTLQYEDNVTNPEDMRPYCWHYPPKPCGIVPARS VCGPVYCFTPSPVVVGTTDARGVPTYTWGENETDVFLLNSTRPPRGSWFGCTWMNSTGFT KTCGAPPCRIRADFNASTDLLCPTDCFRKHSDATYIKCGSGPWLTPKCMVDYPYRLWHYP CTVNYSIFKIRMYVGGVEHRLTAACNFTRGDPCNLEDRDRSQLSPLLHSTTEWAILPCTY SDLPALSTGLLHLHQNIVDVQYMYGLSPALTKYVVRWEWVVLLFLLLADARVCA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GATA3 Rabbit Monoclonal Antibody [Clone ID: R05-3G0]
TA421696 100 µL

GATA3 Rabbit Monoclonal Antibody [Clone ID: R05-3G0]

Sign In for Pricing
View Details
Human FBXL16 activation kit by CRISPRa
GA115556 1 Kit

Human FBXL16 activation kit by CRISPRa

Sign In for Pricing
View Details
Human STK11IP activation kit by CRISPRa
GA114455 1 Kit

Human STK11IP activation kit by CRISPRa

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-16278-01 20 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-16278-02 60 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details
BGLAP Polyclonal Antibody
E-AB-16278-03 120 µL

BGLAP Polyclonal Antibody

Sign In for Pricing
View Details