Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Epoxide hydrolase 4 (Ephx4)

This Recombinant Mouse Epoxide hydrolase 4 (Ephx4) spans the amino acid sequence from region 1-359.

Product Specifications

Product Name Alternative

Epoxide hydrolase 4, EC= 3.3.-.-, Abhydrolase domain-containing protein 7, Epoxide hydrolase-related protein

UniProt

Q6IE26

Expression Region

1-359

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPPRPPRLLPALRALLYWSLVYGYCGLCASVHLLKLLWSIGRAPAQTFRRAARANPPAC LNDPSLGTHCYVRIKDSGLRFHYVAAGERGKPLMLLLHGFPEFWYSWRHQLREFKSEYRV VALDLRGYGESDAPAHQESYKLDCLIADIKDILDSLGYSKCVLIGHDWGGMIAWLIAVCY PEMIMKLIVINFPHPSVFTEYILRHPAQLFRSSFYYFFQIPRFPEFMFSINDFKVLKHLF TSQSTGIGRKGRQLTTEDLEAYVYVFSQPGALSGPINHYRNIFSCLPLKHHMVTTPTLLL WGEEDAFMEVEMAEVTKIYVKNYFRLTILSEGSHWLQQDQPDIVNGLIWAFLKEETRRD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TSTD2 (NM_139246) Human Over-expression Lysate
LH13991V 100 µg

TSTD2 (NM_139246) Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-Olfactory receptor 11L1 OR11L1 Antibody
A30859 100 µL

Anti-Olfactory receptor 11L1 OR11L1 Antibody

Sign In for Pricing
View Details
ATF4 Rabbit Polyclonal Antibody (Cy5)
orb908229 100 µL

ATF4 Rabbit Polyclonal Antibody (Cy5)

Sign In for Pricing
View Details
Mab21l2 Mouse qPCR Primer Pair (NM_011839)
MP207717 200 Reactions

Mab21l2 Mouse qPCR Primer Pair (NM_011839)

Sign In for Pricing
View Details
Human COL18A1 Recombinant Protein
PPT-11963 100 µg

Human COL18A1 Recombinant Protein

Sign In for Pricing
View Details
PDGFC Peptide - N-terminal region
orb1999736 100 µg

PDGFC Peptide - N-terminal region

Sign In for Pricing
View Details