Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGFC Peptide - N-terminal region

PDGFC Peptide - N-terminal region

Product Specifications

Product Name Alternative

SCDGF, FALLOTEIN

UniProt

Q9NRA1

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_057289.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QAESNLSSKFQFSSNKEQNGVQDPQHERIITVSTNGSIHSPRFPHTYPRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PFPV25.1-miRFP670 Plasmid
PVT68320 2 µg

PFPV25.1-miRFP670 Plasmid

Sign In for Pricing
View Details
Aftiphilin HDR Plasmid (h)
sc-407964-HDR 20 µg

Aftiphilin HDR Plasmid (h)

Sign In for Pricing
View Details
SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone
RG227852 10 µg

SKIP (INPP5K) (NM_001135642) Human Tagged ORF Clone

Sign In for Pricing
View Details
Camel Myosin Light Chain 3 (MYL3) ELISA Kit
MBS9346827-01 48 Well

Camel Myosin Light Chain 3 (MYL3) ELISA Kit

Sign In for Pricing
View Details
Camel Myosin Light Chain 3 (MYL3) ELISA Kit
MBS9346827-02 96 Well

Camel Myosin Light Chain 3 (MYL3) ELISA Kit

Sign In for Pricing
View Details
Camel Myosin Light Chain 3 (MYL3) ELISA Kit
MBS9346827-03 5x 96 Well

Camel Myosin Light Chain 3 (MYL3) ELISA Kit

Sign In for Pricing
View Details