Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094)

This Recombinant Gallid herpesvirus 2 Envelope glycoprotein D (MDV094) spans the amino acid sequence from region 35-403.

Product Specifications

Product Name Alternative

Envelope glycoprotein D, gD

UniProt

Q9E6L6

Expression Region

35-403

Origin

Gallid herpesvirus 2 (strain Chicken/Md5/ATCC VR-987) (GaHV-2) (Marek's disease herpesvirus type 1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGLKKDNSPIIPTLHPKGNENLRATLNEYKIPSPLFDTLDNSYETKHVIYTDNCSFAVLN PFGDPKYTLLSLLLMGRRKYDALVAWFVLGRACGRPIYLREYANCSTNEPFGTCKLKSLG WWDRRYAMTSYIDRDELKLIIAAPSRELSGLYTRLIIINGEPISSDILLTVKETCSFSRR GIKDNKLCKPFSFFVNGTTRLLDMVGTGTPRAHEENVKQWLERIGGKHLPIVVETSMQQV SNLPRSFRDSYFKSPDDDKYDDVKMTSATTNNITTSVDGYTGLTNRPEDFEKAPYITKRP IISVEEASSQSPKISTEKKSRTQIIISLVVLCVMFCFIVIGSGIWILRKHRKTVMYDRRR PSRRAYSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]
TA500462BM 100 µL

B Raf (BRAF) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4C11]

Sign In for Pricing
View Details
Recombinant Human PPM1G/PP2C-gamma Protein (His Tag)
PKSH032970-01 10 µg

Recombinant Human PPM1G/PP2C-gamma Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PPM1G/PP2C-gamma Protein (His Tag)
PKSH032970-02 50 µg

Recombinant Human PPM1G/PP2C-gamma Protein (His Tag)

Sign In for Pricing
View Details
Human C9orf72 activation kit by CRISPRa
GA116437 1 Kit

Human C9orf72 activation kit by CRISPRa

Sign In for Pricing
View Details
Human C1orf110 (CCDC190) activation kit by CRISPRa
GA117433 1 Kit

Human C1orf110 (CCDC190) activation kit by CRISPRa

Sign In for Pricing
View Details
ATP5L2 Antibody
8C14604-AAT 50 µg

ATP5L2 Antibody

Sign In for Pricing
View Details