Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3)

This Recombinant Mouse Peroxisomal biogenesis factor 3 (Pex3) spans the amino acid sequence from region 1-372.

Product Specifications

Product Name Alternative

Peroxisomal biogenesis factor 3, Peroxin-3, Peroxisomal assembly protein PEX3

UniProt

Q9QXY9

Expression Region

1-372

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLRSMWNFLKRHKKKCIFLGTVLGGVYILGKYGQKKIREIQEREAAEYIAQARRQYHFES NQRTCNMTVLSMLPTLREALMQQLNSESLTALLKSRPSNKLEIWEDLKIISFTRSIVAVY STCMLVVLLRVQLNIIGGYIYLDNATVGKNGTTVLAPPDVQQQYLSSIQHLLGDGLTELV TVIKQAVQRILGSVSLKHSLSLLDLEQKLKEIRILVEQHQSSWNDKDVSRSSLCQYMMPD EETPLAAQAYGLSHRDITTIKLLNETRDMLESPDFSTVLNTCLNRGFSRLLDNMAEFFRP TEQDLQHGNSINSLSSVSLPLAKIIPIVNGQIHSVCSETPSHFVQDLLMMEQVKDFAANV YEAFSTPQQLEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Podoplanin (PDPN), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0029472 96 Tests

Multiplex Assay Kit for Podoplanin (PDPN), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Lentiviral human MYO18A shRNA (UAS) - Lentiviral human MYO18A shRNA (UAS, GFP) plasmid
GTR15115594 1 Vial

Lentiviral human MYO18A shRNA (UAS) - Lentiviral human MYO18A shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Anti-Fruit fly l(2)efl/CryAB Antibody, APC Conjugate
DZ33926-APC 200 µL/Vial

Anti-Fruit fly l(2)efl/CryAB Antibody, APC Conjugate

Sign In for Pricing
View Details
SPARC Rabbit Polyclonal Antibody (PE-Cy7)
orb913424 100 µL

SPARC Rabbit Polyclonal Antibody (PE-Cy7)

Sign In for Pricing
View Details
Rabbit Polyclonal MCM3 Antibody [Alexa Fluor 750]
NB100-289AF750 0.1 mL

Rabbit Polyclonal MCM3 Antibody [Alexa Fluor 750]

Sign In for Pricing
View Details
TNF-alpha, Soluble (human) (Recombinant)
32-190047-10 10 µg

TNF-alpha, Soluble (human) (Recombinant)

Sign In for Pricing
View Details