Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus thuringiensis subsp. konkukian UPF0754 membrane protein BT9727_0767 (BT9727_0767)

This Recombinant Bacillus thuringiensis subsp. konkukian UPF0754 membrane protein BT9727_0767 (BT9727_0767) spans the amino acid sequence from region 1-378.

Product Specifications

Product Name Alternative

UPF0754 membrane protein BT9727_0767

UniProt

Q6HMW0

Expression Region

1-378

Origin

Bacillus thuringiensis subsp. konkukian (strain 97-27)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNIWLSMLTTTGLGAIIGGFTNHLAIKMLFRPHRPIYIGKFQVPFTPGLIPKRRDELAVQ LGKMVVEHLLTPEGIGKKLTNEEFQKGLIHWAQVEVDKVITNEQSLRHMLGKWDVAHVEK EATEKIEQVITEKIQAFLEEYYTYTWEQALPHSVHEKIENAIPNVSAFILKRAIHFFESE EGKSRLSKMIDDFFASRGALLNLVGMFLGNVSVVDRVQPEVIKFLGQDGTKQLLTDVLQK EWEKLKGRDVKELETFVEKEMIVSSILSAVKVEETVSKFLNQSVQQVCEPVRETIIEKVV PGVVTKGLKWGTENVESILHNLHLAEIVQQEVSTFSTERLEELVLSITKNELKMITYLGA LLGGMIGIVQGLLLLFLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMPH Antibody (Center)
E45R33034G-4 50 µL

AMPH Antibody (Center)

Sign In for Pricing
View Details
GPT antibody
FNab03619 100 µg

GPT antibody

Sign In for Pricing
View Details
Interleukin 1b, Recombinant, Human
048897 100 µg

Interleukin 1b, Recombinant, Human

Sign In for Pricing
View Details
Porcine Cathepsin Anti-body (Cath Ab) ELISA Kit
NSL0795Po 96 Tests

Porcine Cathepsin Anti-body (Cath Ab) ELISA Kit

Sign In for Pricing
View Details
HLA-U sgRNA CRISPR Lentivector (Human) (Target 3)
K0967204 1.0 µg DNA

HLA-U sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
H-His-Lys-OH · HBr
G-2320.0250 250.0mg

H-His-Lys-OH · HBr

Sign In for Pricing
View Details