Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1

This Recombinant Staphylococcus aureus Na (+) /H (+) antiporter subunit G1 spans the amino acid sequence from region 1-118.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G1, Mnh complex subunit G1

UniProt

P60696

Expression Region

1-118

Origin

Staphylococcus aureus (strain Mu50 / ATCC 700699)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKIILISLALIFVIIGALISALAAIGLLRLEDVYSRAHAAGKASTLGAMSLLFGTFLYF IATQGFVNMQLIVAIIFVLITGPLSSHMIMKAAYNIKTPYTKKTKVDEISEDLKDTKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Malondialdehyde Antibody, Clone 11E3: RPE
SMC-515D-RPE 100 µg

Malondialdehyde Antibody, Clone 11E3: RPE

Sign In for Pricing
View Details
Lentiviral mouse Dchs1 shRNA (UAS) - Lentiviral mouse Dchs1 shRNA (UAS) (25)
GTR15189773 1 Vial

Lentiviral mouse Dchs1 shRNA (UAS) - Lentiviral mouse Dchs1 shRNA (UAS) (25)

Sign In for Pricing
View Details
Oas1d AAV siRNA Pooled Vector
32389166 1.0 µg

Oas1d AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CMKLR1 discontinued
387638 200 µL

CMKLR1 discontinued

Sign In for Pricing
View Details
Dynorphin A (1-11)
D9902-01D 1 mg

Dynorphin A (1-11)

Sign In for Pricing
View Details
PRPS1L1 siRNA Oligos set (Human)
37773171 3x 5 nmol

PRPS1L1 siRNA Oligos set (Human)

Sign In for Pricing
View Details