Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Flagellar protein FliL (fliL)

This Recombinant Flagellar protein FliL (fliL) spans the amino acid sequence from region 1-154.

Product Specifications

Product Name Alternative

Flagellar protein FliL

UniProt

P0ABY1

Expression Region

1-154

Origin

Shigella flexneri

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTDYAISKKSKRSLWIPILVFITLAACASAGYSYWHSHQVAADDKAQQRVVPSPVFYALD TFTVNLGDADRVLYIGITLRLKDEATRSRLSEYLPEVRSRLLLLFSRQDAAVLATEEGKK NLIAEIKTTLSTPLVAGQPKQDVTDVLYTAFILR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dihydroabietic Acid (Technical Grade)
TRC-D487938-50MG 50 mg

Dihydroabietic Acid (Technical Grade)

Sign In for Pricing
View Details
CCBL2 (KYAT3) (NM_001008662) Human Over-expression Lysate
LY423345 100 µg

CCBL2 (KYAT3) (NM_001008662) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Mouse IL-15 protein (His Tag)
PKSM041466-01 20 µg

Recombinant Mouse IL-15 protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-15 protein (His Tag)
PKSM041466-02 100 µg

Recombinant Mouse IL-15 protein (His Tag)

Sign In for Pricing
View Details
RAB11FIP5 (NM_015470) Human Recombinant Protein
TP306173 20 µg

RAB11FIP5 (NM_015470) Human Recombinant Protein

Sign In for Pricing
View Details
TruScript First Strand cDNA Synthesis Kit
54420 50 Reactions

TruScript First Strand cDNA Synthesis Kit

Sign In for Pricing
View Details