Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Popeye domain-containing protein 3 (POPDC3)

This Recombinant Human Popeye domain-containing protein 3 (POPDC3) spans the amino acid sequence from region 1-291.

Product Specifications

Product Name Alternative

Popeye domain-containing protein 3, Popeye protein 3

UniProt

Q9HBV1

Expression Region

1-291

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MERNSSLWKNLIDEHPVCTTWKQEAEGAIYHLASILFVVGFMGGSGFFGLLYVFSLLGLG FLCSAVWAWVDVCAADIFSWNFVLFVICFMQFVHIAYQVRSITFAREFQVLYSSLFQPLG ISLPVFRTIALSSEVVTLEKEHCYAMQGKTSIDKLSLLVSGRIRVTVDGEFLHYIFPLQF LDSPEWDSLRPTEEGIFQVTLTAETDCRYVSWRRKKLYLLFAQHRYISRLFSVLIGSDIA DKLYALNDRVYIGKRYHYDIRLPNFYQMSTPEIRRSPLTQHFQNSRRYCDK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Cathepsin A (CTSA) ELISA Kit
abx150956-01 96 Tests

Human Cathepsin A (CTSA) ELISA Kit

Sign In for Pricing
View Details
Human Cathepsin A (CTSA) ELISA Kit
abx150956-02 5x 96 Tests

Human Cathepsin A (CTSA) ELISA Kit

Sign In for Pricing
View Details
Human Cathepsin A (CTSA) ELISA Kit
abx150956-03 10x 96 Tests

Human Cathepsin A (CTSA) ELISA Kit

Sign In for Pricing
View Details
TAFI (pCPB, Carboxypeptidase U, plasma Carboxypeptidase B, CPU, Carboxypeptidase B2, CPB2, Thrombin Activatable Fibrinolysis) (Biotin)
227174-Biotin 100 µL

TAFI (pCPB, Carboxypeptidase U, plasma Carboxypeptidase B, CPU, Carboxypeptidase B2, CPB2, Thrombin Activatable Fibrinolysis) (Biotin)

Sign In for Pricing
View Details
HLA E Rabbit Polyclonal Antibody (PE-Cy5.5)
orb912856 100 µL

HLA E Rabbit Polyclonal Antibody (PE-Cy5.5)

Sign In for Pricing
View Details
RAB33A Peptide - C-terminal region
orb2001995 100 µg

RAB33A Peptide - C-terminal region

Sign In for Pricing
View Details