Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB33A Peptide - C-terminal region

RAB33A Peptide - C-terminal region

Product Specifications

Product Name Alternative

RabS10

UniProt

Q14088

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB33A Rabbit Polyclonal Antibody (orb327337) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004785

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KESQNVESIFMCLACRLKAQKSLLYRDAERQQGKVQKLEFPQEANSKTSC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGB rabbit pAb
ES9909-01 50 µL

NGB rabbit pAb

Sign In for Pricing
View Details
NGB rabbit pAb
ES9909-02 100 µL

NGB rabbit pAb

Sign In for Pricing
View Details
IL25 Protein Vector (Human) (pPB-N-His)
PV021366 500 ng

IL25 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat Olfactory receptor 5AS1 (OR5AS1) ELISA kit
GTR10467677 96 Well

Rat Olfactory receptor 5AS1 (OR5AS1) ELISA kit

Sign In for Pricing
View Details
GAL3ST4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
21207064 1.0 µg DNA

GAL3ST4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TREML3 sgRNA CRISPR Lentivector (Human) (Target 3)
K2459304 1.0 µg DNA

TREML3 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details