Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb0909 (Mb0909)

This Recombinant Uncharacterized protein Mb0909 (Mb0909) spans the amino acid sequence from region 1-340.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb0909

UniProt

P0A5D6

Expression Region

1-340

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDRTRIVRRWRRNMDVADDAEYVEMLATLSEGSVRRNFNPYTDIDWESPEFAVTDNDPRW ILPATDPLGRHPWYQAQSRERQIEIGMWRQANVAKVGLHFESILIRGLMNYTFWMPNGSP EYRYCLHESVEECNHTMMFQEMVNRVGADVPGLPRRLRWVSPLVPLVAGPLPVAFFIGVL AGEEPIDHTQKNVLREGKSLHPIMERVMSIHVAEEARHISFAHEYLRKRLPRLTRMQRFW ISLYFPLTMRSLCNAIVVPPKAFWEEFDIPREVKKELFFGSPESRKWLCDMFADARMLAH DTGLMNPIARLVWRLCKIDGKPSRYRSEPQRQHLAAAPAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP1 Rabbit Polyclonal Antibody (Biotin)
orb2139624 100 µL

FOXP1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
SKOR1 siRNA (Human)
CRJ7989-01 15 nmol

SKOR1 siRNA (Human)

Sign In for Pricing
View Details
SKOR1 siRNA (Human)
CRJ7989-02 30 nmol

SKOR1 siRNA (Human)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Prolipoprotein diacylglyceryl transferase (lgt)
orb2907981-01 20 µg

Recombinant Coxiella burnetii Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Recombinant Coxiella burnetii Prolipoprotein diacylglyceryl transferase (lgt)
orb2907981-02 100 µg

Recombinant Coxiella burnetii Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
KIF3B Antibody
MBS9430679-01 0.1 mL

KIF3B Antibody

Sign In for Pricing
View Details