Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXP1 Rabbit Polyclonal Antibody (Biotin)

FOXP1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MFH, QRF1, 12CC4, hFKH1B, HSPC215

UniProt

Q9H334

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FOXP1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MIPTELQQLWKEVTSAHTAEETTGNNHSSLDLTTTCVSSSAPSKTSLI

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_116071

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 550)
MBS6471796-01 0.1 mL

Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 550)

Sign In for Pricing
View Details
Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 550)
MBS6471796-02 5x 0.1 mL

Cytomegalovirus, Strain AD 169 (CMV) (MaxLight 550)

Sign In for Pricing
View Details
LentimiRa-hsa-miR-193b-3p Vector
mh40242 500 ng

LentimiRa-hsa-miR-193b-3p Vector

Sign In for Pricing
View Details
FDFT1, ID (Farnesyl-diphosphate Farnesyltransferase, Squalene Synthetase, SQS, SS, FPP:FPP farnesyltransferase) (MaxLight 750)
MBS6475840-01 0.1 mL

FDFT1, ID (Farnesyl-diphosphate Farnesyltransferase, Squalene Synthetase, SQS, SS, FPP:FPP farnesyltransferase) (MaxLight 750)

Sign In for Pricing
View Details
FDFT1, ID (Farnesyl-diphosphate Farnesyltransferase, Squalene Synthetase, SQS, SS, FPP:FPP farnesyltransferase) (MaxLight 750)
MBS6475840-02 5x 0.1 mL

FDFT1, ID (Farnesyl-diphosphate Farnesyltransferase, Squalene Synthetase, SQS, SS, FPP:FPP farnesyltransferase) (MaxLight 750)

Sign In for Pricing
View Details
PE Mouse IgG1, κ Isotype Control
JOT22403F 20Tests

PE Mouse IgG1, κ Isotype Control

Sign In for Pricing
View Details