Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB)

This Recombinant Prochlorococcus marinus Cytochrome c biogenesis protein CcsB (ccsB) spans the amino acid sequence from region 1-429.

Product Specifications

Product Name Alternative

Cytochrome c biogenesis protein CcsB

UniProt

A9BCE8

Expression Region

1-429

Origin

Prochlorococcus marinus (strain MIT 9211)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKVLWRVLNWLSSLKVAILLLFFIALASAIGTFIPQGDQSDNYINNYAKHPWLGLINGHL ILRMQLDHVYSSYWFLFLLSWLGIALMICSWRRQWPTLKAAMKWIDYDQSTQIKKLAISE EVIVQDSGLAIKKLHNQLISSGWDVKADSNRIAARKGVIGRFGPPLVHFGLIFLMIGATL GALEGQRVEKFLEPGKSIDLISPDGINKLKIKLKDFQILRLPNGQPEQFLSKVELSDGSN QQPISREISVNHPLRFQGLTIYQADWALSGINMQFGNSPKLQLPLKAIPELGEQVWGISL PDLDNAGKSILLTISSETGPARFYSQEGKSITEITPGGNKEIINGLETQVIEVLQSSGIL IKYDPGVPLVYIGFAITLIGSLISIISTKMLWALWEEENGLLFIGGLSNRNLSGFANDFP TLLKVIKSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6V1 Human Gene Knockout Kit (CRISPR)
KN418286 1 Kit

OR6V1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human XIAP protein (His tag)
PDEH100976-01 20 µg

Recombinant Human XIAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human XIAP protein (His tag)
PDEH100976-02 100 µg

Recombinant Human XIAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human XIAP protein (His tag)
PDEH100976-03 500 µg

Recombinant Human XIAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human XIAP protein (His tag)
PDEH100976-04 1 mg

Recombinant Human XIAP protein (His tag)

Sign In for Pricing
View Details
Mouse LIF Antibody Pair Set
E-KAB-0595 50 µL & 100 µg

Mouse LIF Antibody Pair Set

Sign In for Pricing
View Details