Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xanthomonas phage phiLf Gene 1 protein (I)

This Recombinant Xanthomonas phage phiLf Gene 1 protein (I) spans the amino acid sequence from region 1-440.

Product Specifications

Product Name Alternative

Gene 1 protein, G1P

UniProt

O55247

Expression Region

1-440

Origin

Xanthomonas phage phiLf (Bacteriophage phi-Lf)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVFNEGVPRAGKSYDAVKNHILPALKKGRRVFARLNGLRFDRIAKHLGMAENDVQHLLV LVDTKDVSKLFACTQDESGKWCIPDEFKDALVVIDEVHEFYVNERKPLAPAVENFWALLG QNGGDAVIMTQWINRLHSAVKARIEKKNTFQKLTAIGMKGRYRVTYFHTTSPGKFEKVGG QTLKYDPAIFPLYDGYAPGAENTEVYEEGGKNVWAAMAVRAAIFLTLGGVGIYFFMHYFT KDRADPNKPMASASQTTKPTHVGAGFANGAPSVPIQPPPPDPLADLTQEQRYVAQLADKG RIRLSARARVGDQDRAWIQWIDASNNVVEELDLSQLRALGYSVSVVTYGVRLSAGKHIMV ATAWPWTAPIREKDARLYNMAPDGSGGAAGVATAGSDGGGADRDQVRGGVIEYGPRTQGT FPDNKGYSSSTSTPATTLQM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Lung
CR560218 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
Zfp827 Mouse Gene Knockout Kit (CRISPR)
KN520001 1 Kit

Zfp827 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
WDR90 Human Gene Knockout Kit (CRISPR)
KN422427 1 Kit

WDR90 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 11/KLK11 Protein (His Tag)
PKSH033404-01 10 µg

Recombinant Human Kallikrein 11/KLK11 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Kallikrein 11/KLK11 Protein (His Tag)
PKSH033404-02 50 µg

Recombinant Human Kallikrein 11/KLK11 Protein (His Tag)

Sign In for Pricing
View Details
Succinyl Triticum vulgare (Wheat Germ) -Succinyl WGA Gel Immobilized Lectin
A-2102-2 2 mL

Succinyl Triticum vulgare (Wheat Germ) -Succinyl WGA Gel Immobilized Lectin

Sign In for Pricing
View Details