Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Coiled-coil domain-containing protein 47 (CCDC47)

This Recombinant Bovine Coiled-coil domain-containing protein 47 (CCDC47) spans the amino acid sequence from region 21-483.

Product Specifications

Product Name Alternative

Coiled-coil domain-containing protein 47

UniProt

Q3ZC50

Expression Region

21-483

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

KFDDFEDEEDIVEYDDNDFAEFEDVAEDSVTESPQRVIITEDDEDETTVELEGQDESQEG DFEDADTQEGDTESEPYDDEEFEGYEDKPDTSSSKSKDPITIVDVPAHLQNSWESYYLEI LMVTGLLAYIMNYIIGKNKNSRLAQAWFNTHRELLESNFTLVGDDGTNKEATSTGKLNQE NEHIYNLWCSGRVCCEGMLIQLRFLKRQDLLNVLARMMRPVSDQVQIKVTMNDEDMDTYV FAVGARKALVRLQKEMQDLSEFCSDKPKSGAKYGLPDSLAILSEMGEVTDGMMDTKMLHF LTHYADKIESIHFSDQFSGPKIMQEEGQPLKLPDTKRTLLFTFNVPGSGNTYPKDMEALL PLMNMVIYSIDKAKKFRLNREGKQKADKNRARVEENFLKLTHVQRQEAAQSRREEKKRAE KERIMNEEDPEKQRRLEEAALRREQKKLEKKQMKMKQIKVKAM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Proteoglycan 3/PRG3 Protein (His Tag)
PKSH032976-01 10 µg

Recombinant Human Proteoglycan 3/PRG3 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Proteoglycan 3/PRG3 Protein (His Tag)
PKSH032976-02 50 µg

Recombinant Human Proteoglycan 3/PRG3 Protein (His Tag)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-,  10nm
GP-6803-10 1 mL

Colloidal Gold Conjugated Sambucus nigra (Elderberry Bark) -SNA-II-, 10nm

Sign In for Pricing
View Details
Recombinant Rat CLPS/Colipase Protein (His Tag)
PKSR030146 100 µg

Recombinant Rat CLPS/Colipase Protein (His Tag)

Sign In for Pricing
View Details
TNF Rabbit Polyclonal Antibody
TA397304S 25 µL

TNF Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS634634 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details