Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2)

This Recombinant Staphylococcus aureus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q2FXE5

Expression Region

1-117

Origin

Staphylococcus aureus (strain NCTC 8325)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISIILVMIGGGFGAIARSAITDYFNHKFTSKLPIATLIVNLVGSFLIGLTIGLSISISW FPAFFVTGFLGGLTTFSTLAKELTLMMTPKFNINLFLNYSLLQFIIGFIACYIGYHI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC15 Antibody
KC-27154-01 50 μL

CCDC15 Antibody

Sign In for Pricing
View Details
CCDC15 Antibody
KC-27154-02 100 µL

CCDC15 Antibody

Sign In for Pricing
View Details
CCDC15 Antibody
KC-27154-03 1 mL

CCDC15 Antibody

Sign In for Pricing
View Details
Recombinant Human CCL17/TARC Protein (His Tag)
PKSH033735-01 10 µg

Recombinant Human CCL17/TARC Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CCL17/TARC Protein (His Tag)
PKSH033735-02 50 µg

Recombinant Human CCL17/TARC Protein (His Tag)

Sign In for Pricing
View Details
TSTD3 (TAF-I beta) Rabbit Polyclonal Antibody
AP20445PU-N 100 µg

TSTD3 (TAF-I beta) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details