Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein EbrB (ebrB)

This Recombinant Multidrug resistance protein EbrB (ebrB) spans the amino acid sequence from region 1-117.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrB

UniProt

P0CW83

Expression Region

1-117

Origin

Bacillus atrophaeus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKGLLYLALAIVSEVFGSTMLKLSEGFTQAWPIGGVIAGFLSAFTFLSFSLKTIDLSSAY ATWSGVGTALTAIVGFLLFGETISLKGVFGLTLVIAGVVVLNQSKAPAKEKKQTVCE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guanidinosuccinic acid
MBS5758414 Inquire

Guanidinosuccinic acid

Sign In for Pricing
View Details
DDHD1 AAV siRNA Pooled Vector
17774161 1.0 µg

DDHD1 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IL11RA Antibody
26-139 100 µL

IL11RA Antibody

Sign In for Pricing
View Details
Rabbit anti-HLA-C Antibody
MBS4505963-01 0.05 mL

Rabbit anti-HLA-C Antibody

Sign In for Pricing
View Details
Rabbit anti-HLA-C Antibody
MBS4505963-02 0.1 mL

Rabbit anti-HLA-C Antibody

Sign In for Pricing
View Details
Rabbit anti-HLA-C Antibody
MBS4505963-03 5x 0.1 mL

Rabbit anti-HLA-C Antibody

Sign In for Pricing
View Details