Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtJ (mdtJ)

This Recombinant Spermidine export protein MdtJ (mdtJ) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Spermidine export protein MdtJ

UniProt

Q8XEK5

Expression Region

1-120

Origin

Salmonella typhi

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFYWILLALAIATEITGTLSMKWASVGNGNAGFILMLVMITLSYIFLSFAVKKIALGVAY ALWEGIGILFITIFSVLLFDEALSTMKIAGLLTLVAGIVLIKSGTRKPGKPVKEATRATI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CHRDL1 Antibody
MBS9215443-01 0.1 mL

CHRDL1 Antibody

Sign In for Pricing
View Details
CHRDL1 Antibody
MBS9215443-02 5x 0.1 mL

CHRDL1 Antibody

Sign In for Pricing
View Details
Recombinant human p23/PTGES3 protein
ATGP0418-100 100 µg

Recombinant human p23/PTGES3 protein

Sign In for Pricing
View Details
FOLR2, NT (FOLR2, Folate receptor beta, Folate receptor 2, Folate receptor, fetal/placental, Placental folate-binding protein) (PE)
MBS6299620-01 0.2 mL

FOLR2, NT (FOLR2, Folate receptor beta, Folate receptor 2, Folate receptor, fetal/placental, Placental folate-binding protein) (PE)

Sign In for Pricing
View Details
FOLR2, NT (FOLR2, Folate receptor beta, Folate receptor 2, Folate receptor, fetal/placental, Placental folate-binding protein) (PE)
MBS6299620-02 5x 0.2 mL

FOLR2, NT (FOLR2, Folate receptor beta, Folate receptor 2, Folate receptor, fetal/placental, Placental folate-binding protein) (PE)

Sign In for Pricing
View Details
MUC5B Polyclonal Antibody
bs-23915R 100 µL

MUC5B Polyclonal Antibody

Sign In for Pricing
View Details