Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1)

This Recombinant Staphylococcus epidermidis Protein CrcB homolog 1 (crcB1) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Protein CrcB homolog 1

UniProt

Q5HND1

Expression Region

1-121

Origin

Staphylococcus epidermidis (strain ATCC 35984 / RP62A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQYLYIFVGGALGALIRFCLSMLNEGSTIPLGTFVANLLGAFLMGSIGALSLSLFKTHPN IKKGLTTGLLGALTTFSTFQFELVTLFNQHHFILFTIYGVTSYILGILSCYLGVKIGGRF S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Aza-2-thiouridine
TRC-A803358-50MG 50 mg

6-Aza-2-thiouridine

Sign In for Pricing
View Details
P57 / KIP2 (KP10 + KIP2/880), CF405S conjugate, 0.1mg/mL
BNC041015-500 1x 500 µL

P57 / KIP2 (KP10 + KIP2/880), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cdkn2d (NM_009878) Mouse Tagged ORF Clone
MG201344 10 µg

Cdkn2d (NM_009878) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Phospho-CD3 ζ (Tyr142) antibody
FNab09792 100 µg

Phospho-CD3 ζ (Tyr142) antibody

Sign In for Pricing
View Details
ACAT1 Human Knockdown Lysate
LY300019 100 µg

ACAT1 Human Knockdown Lysate

Sign In for Pricing
View Details
IKZF3 Polyclonal Antibody
E-AB-14763-01 20 µL

IKZF3 Polyclonal Antibody

Sign In for Pricing
View Details