Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q46IH7

Expression Region

1-124

Origin

Prochlorococcus marinus (strain NATL2A)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSDILFVSIGAILGANIRFQIHHKLGNLNLDKGFLILIINTFASFGLGLFLSLVEQFRAF TYSYQLILFFSIGFFGSLSTFSSFVYDLFDLCLQLELFRALKLFIISVSIGIIAFAFGLF LGTQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (APC)
MBS6451136-01 0.1 mL

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (APC)

Sign In for Pricing
View Details
IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (APC)
MBS6451136-02 5x 0.1 mL

IDO1 (Indoleamine 2,3-dioxygenase 1, CD107B, IDO, INDO) (APC)

Sign In for Pricing
View Details
Mouse Galectin-7/LGALS7 ELISA Kit
orb180645 96 Tests

Mouse Galectin-7/LGALS7 ELISA Kit

Sign In for Pricing
View Details
AZIN1 Polyclonal Antibody
A62142-100 100 µL

AZIN1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal RPS11 Antibody [DyLight 405]
NBP2-22289V 0.1 mL

Rabbit Polyclonal RPS11 Antibody [DyLight 405]

Sign In for Pricing
View Details
CD20 Antibody [AISB12]
76-010 0.1 mg

CD20 Antibody [AISB12]

Sign In for Pricing
View Details