Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosococcus oceani Protein CrcB homolog (crcB)

This Recombinant Nitrosococcus oceani Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-125.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

Q3J8V3

Expression Region

1-125

Origin

Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWQKLAWIALAGAGGTLSRYALSGLVQNLCGASFPWGTWVVNGLGCFLFGMIWALAEERL LITGEIRFIVLTGFMGAFTTFSTFAFEASQFLRDSEWLLAAIHLIGQNSLGLVCVFLGFT ISQII

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp688 3'UTR Lenti-reporter-Luc Vector
51085084 1.0 µg

Zfp688 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PAH Peptide
42-653P 0.1 mg

PAH Peptide

Sign In for Pricing
View Details
VACWR150 protein
orb704859-01 20 µg

VACWR150 protein

Sign In for Pricing
View Details
VACWR150 protein
orb704859-02 100 µg

VACWR150 protein

Sign In for Pricing
View Details
VACWR150 protein
orb704859-03 1 mg

VACWR150 protein

Sign In for Pricing
View Details
Mouse Monoclonal IL-32 alpha Antibody (12) [DyLight 594]
NBP3-06577DL594 0.1 mL

Mouse Monoclonal IL-32 alpha Antibody (12) [DyLight 594]

Sign In for Pricing
View Details