Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VACWR150 protein

This VACWR150 protein spans the amino acid sequence from region 1-110aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

P11258

Expression Region

1-110aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGTLFPGDDDLAIPATEFFSTKAAKKPEAKREAIVKADEDDNEETLKQRLTNLEKKITNVTTKFEQIEKCCKRNDEVLFRLENHAETLRAAMISLAKKIDVQTGRRPYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4orf44 Polyclonal Antibody, RBITC Conjugated
bs-9998R-RBITC 100 µL

C4orf44 Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
PSA antibody
70R-7574 1 mg

PSA antibody

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen, DP Alpha 1 Chain (HLA-DPA1) Antibody
abx029786-01 80 µL

HLA Class II Histocompatibility Antigen, DP Alpha 1 Chain (HLA-DPA1) Antibody

Sign In for Pricing
View Details
HLA Class II Histocompatibility Antigen, DP Alpha 1 Chain (HLA-DPA1) Antibody
abx029786-02 400 µL

HLA Class II Histocompatibility Antigen, DP Alpha 1 Chain (HLA-DPA1) Antibody

Sign In for Pricing
View Details
Rabbit Monoclonal ERK2 Antibody (7I5L7)
NBP3-15826-100ul 100 µL

Rabbit Monoclonal ERK2 Antibody (7I5L7)

Sign In for Pricing
View Details
FAM45A CRISPR Knock Out 293T Cell Line (Human)
20029141 1x 10^6 Cells / 1.0 mL

FAM45A CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details