Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2)

This Recombinant Prochlorococcus marinus Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-130.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q7V9N5

Expression Region

1-130

Origin

Prochlorococcus marinus (strain SARG / CCMP1375 / SS120)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFDGLSTYKSFFLVAFGAVPGAICRMKISDNLFRNKHNLWGILLVNSSACLLLGFFLAKQ NYIHYINNDQPLYLLLCVGFLGSFSTFSSLILEIYYLFVDQQWMELFLFTFTSIGLGIIF ISLGSHLFNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D-Glucosamine Sulfate Salt
TRC-G515100-5G 5 g

D-Glucosamine Sulfate Salt

Sign In for Pricing
View Details
Frozen Tissue Blocks, Kidney
CB547945 1 Block

Frozen Tissue Blocks, Kidney

Sign In for Pricing
View Details
ISG20L2 (NM_030980) Human Over-expression Lysate
LC403104 20 µg

ISG20L2 (NM_030980) Human Over-expression Lysate

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR561438 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
CD45RO (UCHL1 + T200/797), CF647 conjugate, 0.1mg/mL
BNC471209-100 1x 100 µL

CD45RO (UCHL1 + T200/797), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
14-3-3 Theta Recombinant Rabbit Monoclonal Antibody [SD084-02]
ET1612-97 100 µL

14-3-3 Theta Recombinant Rabbit Monoclonal Antibody [SD084-02]

Sign In for Pricing
View Details