Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Holin-like protein CidA (cidA)

This Recombinant Staphylococcus aureus Holin-like protein CidA (cidA) spans the amino acid sequence from region 1-131.

Product Specifications

Product Name Alternative

Holin-like protein CidA

UniProt

P60648

Expression Region

1-131

Origin

Staphylococcus aureus (strain MW2)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHKVQLIIKLLLQLGIIIVITYIGTEIQKIFHLPLAGSIVGLFLFYLLLQFKIVPLTWVE DGANFLLKTMVFFFIPSVVGIMDVASEITLNYILFFAVIIIGTCIVALSSGYIAEKMSVK HKHRKGVDAYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Succinyl-CoA Synthetase (SCS) Activity Assay Kit
E-BC-K906-M-01 48 T (32 samples)

Succinyl-CoA Synthetase (SCS) Activity Assay Kit

Sign In for Pricing
View Details
Succinyl-CoA Synthetase (SCS) Activity Assay Kit
E-BC-K906-M-02 96 T (80 samples)

Succinyl-CoA Synthetase (SCS) Activity Assay Kit

Sign In for Pricing
View Details
EGFR Rabbit Monoclonal Antibody [Clone ID: Matuzumab]
TA386006 200 µg

EGFR Rabbit Monoclonal Antibody [Clone ID: Matuzumab]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131M-01 50 Tests

Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131M-02 100 Tests

Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]
E-AB-F1131M-03 2x 100 Tests

Elab Fluor® 647 Anti-Mouse CD279/PD-1 Antibody[29F.1A12]

Sign In for Pricing
View Details