Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD)

This Recombinant Bacillus subtilis Putative oxidoreductase CatD (catD) spans the amino acid sequence from region 1-134.

Product Specifications

Product Name Alternative

Putative oxidoreductase CatD, EC= 1.-.-.-

UniProt

P54720

Expression Region

1-134

Origin

Bacillus subtilis (strain 168)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKSFEIGTLLLRVITGIIFFVHGLSKFQGMEGTIQFFGSIGLPSFMAYVIAAIELIGGV LVFFGLATRIVGVLFALTLIGAIITVKLKAPFMGNAEFDYLLLLTSIHLALTGSRFLALD PFVFKGKKNGNVSA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OAS2 (NM_001032731) Human Over-expression Lysate
LY422333 100 µg

OAS2 (NM_001032731) Human Over-expression Lysate

Sign In for Pricing
View Details
TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]
TA506654AM 100 µL

TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
Recombinant TLS/FUS Monoclonal Antibody
AN301003L-01 50 µL

Recombinant TLS/FUS Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant TLS/FUS Monoclonal Antibody
AN301003L-02 100 µL

Recombinant TLS/FUS Monoclonal Antibody

Sign In for Pricing
View Details
AMPK beta 1 (PRKAB1) Rabbit Polyclonal Antibody
AP20964PU-N 100 µg

AMPK beta 1 (PRKAB1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS639372 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details