Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2)

This Recombinant Staphylococcus aureus Putative antiporter subunit mnhB2 (mnhB2) spans the amino acid sequence from region 1-141.

Product Specifications

Product Name Alternative

Putative antiporter subunit mnhB2, Mrp complex subunit B2, Putative NADH-ubiquinone oxidoreductase subunit mnhB2

UniProt

Q7A727

Expression Region

1-141

Origin

Staphylococcus aureus (strain N315)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKENDVVLRTVTKLVVFILLTFGFYVFFAGHNNPGGGFIGGLIFSSAFILMFLAFNVEEV LESLPIDFRILMIIGALVSSITAIIPMFFGKPFLSQYETTWILPILGQIHVSTITLFELG ILFSVVGVIVTVMLSLSGGRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOG Double Nickase Plasmid (m)
sc-421688-NIC 20 µg

MOG Double Nickase Plasmid (m)

Sign In for Pricing
View Details
2-Aminobenzene-1,4-diol Hydrochloride
TRC-A591445-1G 1 g

2-Aminobenzene-1,4-diol Hydrochloride

Sign In for Pricing
View Details
Rabbit Polyclonal FBXO7 Antibody [Janelia Fluor 549]
NBP2-97739JF549 0.1 mL

Rabbit Polyclonal FBXO7 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
LTBP2 (NM_000428) Human Tagged ORF Clone
RC209838 10 µg

LTBP2 (NM_000428) Human Tagged ORF Clone

Sign In for Pricing
View Details
Cenpf siRNA Oligos set (Mouse)
15874174 3x 5 nmol

Cenpf siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
Mouse Ksr1 Antibody
57-513 400 µL

Mouse Ksr1 Antibody

Sign In for Pricing
View Details