What is the catalog number for Recombinant Human MAL-like protein (MALL)?

The catalog number for Recombinant Human MAL-like protein (MALL) is orb2920805.

What sizes are available for Recombinant Human MAL-like protein (MALL)?

Recombinant Human MAL-like protein (MALL) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Human MAL-like protein (MALL) come in?

Recombinant Human MAL-like protein (MALL) is available in 2 different pack sizes.

Is Recombinant Human MAL-like protein (MALL) in stock?

Recombinant Human MAL-like protein (MALL) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Human MAL-like protein (MALL)

This Recombinant Human MAL-like protein (MALL) spans the amino acid sequence from region 1-153.

Product Specifications

Product Name Alternative

MAL-like protein, Protein BENE

UniProt

Q13021

Expression Region

1-153

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MASPDPPATSYAPSDVPSGVALFLTIPFAFFLPELIFGFLVWTMVAATHIVYPLLQGWVM YVSLTSFLISLMFLLSYLFGFYKRFESWRVLDSLYHGTTGILYMSAAVLQVHATIVSEKL LDPRIYYINSAASFFAFIATLLYILHAFSIYYH