Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2041 (AF_2041)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_2041 (AF_2041) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_2041

UniProt

O28238

Expression Region

1-162

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVLAIIFLLNLKPTIYSIVGIFLIIILDVTVAVALYFLLRPVSKNISMLMSLFRIVYAA IFTTALYKIHDLTAFYSILDLGYIFFGIHLFLLGFLVYKSGYMPKWLGALIFIASTGYII DPLLRFSGYAVEIGMYTFFGEVLFAFWLVIKGRKLSEVVSTP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Metabotropic Glutamate Receptor 1 (GRM1) (NM_001278066) Human Tagged ORF Clone
RG239763 10 µg

Metabotropic Glutamate Receptor 1 (GRM1) (NM_001278066) Human Tagged ORF Clone

Sign In for Pricing
View Details
MED12 Rabbit Polyclonal Antibody
HA500331 100 µL

MED12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human GNG2 activation kit by CRISPRa
GA110081 1 Kit

Human GNG2 activation kit by CRISPRa

Sign In for Pricing
View Details
BANF1 (NM_003860) Human Over-expression Lysate
LC401269 20 µg

BANF1 (NM_003860) Human Over-expression Lysate

Sign In for Pricing
View Details
BRAF35 (HMG20B) Rabbit Polyclonal Antibody
AP06758PU-N 100 µg

BRAF35 (HMG20B) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
GMP Human IL-18 Protein
GMP-L18H16-500ug 500 µg

GMP Human IL-18 Protein

Sign In for Pricing
View Details