Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Nitrosomonas eutropha Disulfide bond formation protein B (dsbB)

This Recombinant Nitrosomonas eutropha Disulfide bond formation protein B (dsbB) spans the amino acid sequence from region 1-162.

Product Specifications

Product Name Alternative

Disulfide bond formation protein B, Disulfide oxidoreductase

UniProt

Q0AFX4

Expression Region

1-162

Origin

Nitrosomonas eutropha (strain C91)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRIIFLLIFLACAGLIGYALYLQLMDGLLPCPLCIFQRIAYWLIGITALFTFIHNPQSLG QHIYYGLIILFSLAGAIVAGRQAWLIRFPEAFECGISPEEAFLNGLPLAQWWPNMFEANG DCNDGTWQFLSLTLPDWSLLIFAAFGIIAGLLWHKKYNSINQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LAIR1 Protein Vector (Human) (pPB-N-His)
PV023298 500 ng

LAIR1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Dph2 3'UTR Lenti-reporter-Luc Vector
18533086 1.0 µg

Dph2 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MicroLoop LD Assembly; box of 20 assemblies
B-M5-100LD-B5-R 20 Mounts/Base Assemblies

MicroLoop LD Assembly; box of 20 assemblies

Sign In for Pricing
View Details
Pratosartan
MBS5769796 Inquire

Pratosartan

Sign In for Pricing
View Details
CCR7 Rabbit pAb (APR21268N)
APR21268N-01 50 µL

CCR7 Rabbit pAb (APR21268N)

Sign In for Pricing
View Details
CCR7 Rabbit pAb (APR21268N)
APR21268N-02 100 µL

CCR7 Rabbit pAb (APR21268N)

Sign In for Pricing
View Details