Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCR7 Rabbit pAb (APR21268N)

Product Specifications

Background

The protein encoded by this gene is a member of the G protein-coupled receptor family. This receptor was identified as a gene induced by the Epstein-Barr virus (EBV), and is thought to be a mediator of EBV effects on B lymphocytes. This receptor is expressed in various lymphoid tissues and activates B and T lymphocytes. It has been shown to control the migration of memory T cells to inflamed tissues, as well as stimulate dendritic cell maturation. The chemokine (C-C motif) ligand 19 (CCL19/ECL) has been reported to be a specific ligand of this receptor. Signals mediated by this receptor regulate T cell homeostasis in lymph nodes, and may also function in the activation and polarization of T cells, and in chronic inflammation pathogenesis. Alternative splicing of this gene results in multiple transcript variants.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CCR7 Rabbit pAb (APR21259N8) .

Synonyms

CCR7; BLR2; CC-CKR-7; CCR-7; CD197; CDw197; CMKBR7; EBI1

Gene ID

1236

UniProt

P32248

Cellular Locus

Cell membrane, Multi-pass membrane protein

Applications

WB (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 42kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1236

Uniprot URL

https://www.uniprot.org/uniprot/P32248

AA Sequence

MDLGKPMKSVLVVALLVIFQVCLCQDEVTDDYIGDNTTVDYTLFESLCSKKDVRNFKAWFLPIMYSIICFVGLLGNGLVVLTYIYFKRLKTMTDTYLLNL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

FOXO3 Protein (N-His-KSI, Human)
P504022 100 µg

FOXO3 Protein (N-His-KSI, Human)

Ask
View Details
TRADD Protein (N-His, Human)
P509225 100 µg

TRADD Protein (N-His, Human)

Ask
View Details
CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycop
MBS6247632-01 0.1 mL

CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycop

Ask
View Details
CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycop
MBS6247632-02 5x 0.1 mL

CD44 (CD 44, CDw44, ECM III, ECMRIII, Epican, Extracellular Matrix Receptor III, GP90 Lymphocyte Homing Adhesion Receptor, HCAM, HCELL, Heparan Sulfate Proteoglycan, Hermes Antigen, HUTCH1, Hyaluronate Receptor, Indian Blood Group, Inlu Related p80 Glycop

Ask
View Details
Recombinant Human WDR24 Protein, N-His-SUMO
E55P5255 50 µg

Recombinant Human WDR24 Protein, N-His-SUMO

Ask
View Details
8-SHOGAOL
M20152-01 1 g

8-SHOGAOL

Ask
View Details