Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT (queT)

This Recombinant Lactococcus lactis subsp. cremoris Queuosine precursor transporter QueT (queT) spans the amino acid sequence from region 1-169.

Product Specifications

Product Name Alternative

Queuosine precursor transporter QueT, Queuosine precursor ECF transporter S component QueT

UniProt

A2RM05

Expression Region

1-169

Origin

Lactococcus lactis subsp. cremoris (strain MG1363)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKKSKTYDIVTIAIVAALYVILTMTPGLSAISYGPIQFRVSEMLNFTAFFNKKYIIAVTI GCMISNFLSFTWVDVIVGGLSTLVFLSLGVLLFDRFKEDYFWNGQLNKAFFFFAIFFSIS MFTIALELKFVAETPFLLTWGTLALGEFASLFIGAFIMDKLGKRVDLSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tubulin polymerization-promoting protein family member 3 (TPPP3) Rat ELISA Kit
H9252 96 Tests

Tubulin polymerization-promoting protein family member 3 (TPPP3) Rat ELISA Kit

Sign In for Pricing
View Details
GRP94 Antibody: ATTO 390
MBS806439-01 0.1 mg

GRP94 Antibody: ATTO 390

Sign In for Pricing
View Details
GRP94 Antibody: ATTO 390
MBS806439-02 5x 0.1 mg

GRP94 Antibody: ATTO 390

Sign In for Pricing
View Details
VCAM-1
S01-M05-L100 100 µg

VCAM-1

Sign In for Pricing
View Details
DYNC1I2 Polyclonal Antibody
MBS8569413-01 0.1 mL

DYNC1I2 Polyclonal Antibody

Sign In for Pricing
View Details
DYNC1I2 Polyclonal Antibody
MBS8569413-02 0.1 mL (AF405L)

DYNC1I2 Polyclonal Antibody

Sign In for Pricing
View Details