Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Inner membrane protein YghB (yghB)

This Recombinant Inner membrane protein YghB (yghB) spans the amino acid sequence from region 1-219.

Product Specifications

Product Name Alternative

Inner membrane protein YghB

UniProt

P0AA62

Expression Region

1-219

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVIQDIIAALWQHDFAALADPHIVSVVYFVMFATLFLENGLLPASFLPGDSLLILAGAL IAQGVMDFLPTIAILTAAASLGCWLSYIQGRWLGNTKTVKGWLAQLPAKYHQRATCMFDR HGLLALLAGRFLAFVRTLLPTMAGISGLPNRRFQFFNWLSGLLWVSVVTSFGYALSMIPF VKRHEDQVMTFLMILPIALLTAGLLGTLFVVIKKKYCNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)
PKSH032093-01 10 µg

Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)
PKSH032093-02 50 µg

Recombinant Human Arylsulfatase A/ARSA Protein (His Tag)

Sign In for Pricing
View Details
Human Cyclin B3 (CCNB3) activation kit by CRISPRa
GA113878 1 Kit

Human Cyclin B3 (CCNB3) activation kit by CRISPRa

Sign In for Pricing
View Details
CD6 Mouse Monoclonal Antibody [Clone ID: C6/372 + 3F7B5]
AM50243PU-T 20 µg

CD6 Mouse Monoclonal Antibody [Clone ID: C6/372 + 3F7B5]

Sign In for Pricing
View Details
Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D11]
TA500563AM 100 µL

Protein kinase Y linked (PRKY) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3D11]

Sign In for Pricing
View Details
GBA3 Antibody
KC-7293-01 50 μL

GBA3 Antibody

Sign In for Pricing
View Details