Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Tetraspanin-2 (Tspan2)

This Recombinant Mouse Tetraspanin-2 (Tspan2) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Tetraspanin-2, Tspan-2

UniProt

Q922J6

Expression Region

1-221

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGRFRGGLRCIKYLLLGFNLLFWLAGSAVIAFGLWFRFGGTMKDLSSEDKSPEYFYVGLY VLVGAGALMMTVGFFGCCGAMRESQCVLGSFFTCLLVIFAAEVTTGVFAFIGKDVAIRHV QSMYEEAYSDYLKDRARGNGTLITFHSAFQCCGKESSEQVQPTCPKELPGHKNCIDKIET VISAKLQLIGIVGIGIAGLTIFGMIFSMVLCCAIRNSRDVI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD38 Antibody
KC-945-01 50 μL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-945-02 100 µL

CD38 Antibody

Sign In for Pricing
View Details
CD38 Antibody
KC-945-03 1 mL

CD38 Antibody

Sign In for Pricing
View Details
Human PRR9 activation kit by CRISPRa
GA118634 1 Kit

Human PRR9 activation kit by CRISPRa

Sign In for Pricing
View Details
Beta III Tubulin Rabbit Polyclonal Antibody
0805-3 100 µL

Beta III Tubulin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Vinylpyridine (>90%)
TRC-V487500-1G 1 g

3-Vinylpyridine (>90%)

Sign In for Pricing
View Details