Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vibrio cholerae serotype O1 Electron transport complex protein RnfE (rnfE)

This Recombinant Vibrio cholerae serotype O1 Electron transport complex protein RnfE (rnfE) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Electron transport complex protein RnfE

UniProt

A5F2S7

Expression Region

1-230

Origin

Vibrio cholerae serotype O1 (strain ATCC 39541 / Ogawa 395 / O395)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSENRTLMLNGMWNNNPALVQLLGLCPLLAVSSTVTNALGLGIATLLVLVGSNVTVSLVR DYVPKEVRIPVFVMIIASLVTCVQLLMNAYAYGLYLSLGIFIPLIVTNCIIIGRAEAFAS KNDVLPAALDGFWMGLGMTSVLVVLGSLREIIGNGTLFDGADLLLGEWAKVLRIEVFHFD SAFLLALLPPGAFIGVGFLIAAKSVIDKQIAARQPKQQKQAIERARVTNV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Nitroanisole
TRC-N491950-25G 25 g

2-Nitroanisole

Sign In for Pricing
View Details
Crospovidone ~40,000
TRC-C817000-2.5G 2.5 g

Crospovidone ~40,000

Sign In for Pricing
View Details
Fluoroshield with DAPI & DABCO
AR-6505-01 20 mL

Fluoroshield with DAPI & DABCO

Sign In for Pricing
View Details
CACNG3 Rabbit Polyclonal Antibody
AP05142PU-N 100 µg

CACNG3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Calretinin (CALB2) Rabbit Polyclonal Antibody
TA367425 100 µL

Calretinin (CALB2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Integrin alpha-V Antibody
RC-6946-01 50 μL

Recombinant Integrin alpha-V Antibody

Sign In for Pricing
View Details