Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yknW (yknW)

This Recombinant Bacillus subtilis Uncharacterized protein yknW (yknW) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Uncharacterized protein yknW

UniProt

O31709

Expression Region

1-231

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

METNVEKNSGTATEKPSLFGVITSPSVQFERIRERPAVWGPLLIVAAIIIVGAVLQSLGT DYSELLKSQDTQGLSAEQMETVATITKFGGMAGAIIGGIAALFIAPLIYWLCVKVSGGVT TYKKMLSLSLFVSLISSLGLLVNGIVAFTTDVNPLYSTTSLAGIIPSDGALASVLNTFEI FSIWSFVLLAIGLHKTGGISKKAGWISAIILFGILVVFSLFSGLINSVAGA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF3 (NM_001197123) Human Over-expression Lysate
LC434202 20 µg

IRF3 (NM_001197123) Human Over-expression Lysate

Sign In for Pricing
View Details
PCNA Monoclonal Antibody
E-AB-48013-01 25 µL

PCNA Monoclonal Antibody

Sign In for Pricing
View Details
PCNA Monoclonal Antibody
E-AB-48013-02 100 µL

PCNA Monoclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Liver
CR560568 5 µg

Tissue Total RNA, Liver

Sign In for Pricing
View Details
PTP4A3 Rabbit Polyclonal Antibody
AP09464PU-N 100 µL

PTP4A3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Peritoneum
CS712909 5x 5 µm

Tissue FFPE Sections, Peritoneum

Sign In for Pricing
View Details